Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVYYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLT PLGSSELRSPRISYLHFF
    • Amino acids
      1 to 68
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160422 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3.1 gene
    • C5orf13
    • Chromosome 5 open reading frame 13
    • D4S114
    • Neuronal protein 3.1
    • Neuronal regeneration related protein
    • Neuronal regeneration related protein homolog
    • Neuronal regeneration related protein homolog (rat)
    • NP311_HUMAN
    • NREP
    • P311
    • PRO1873
    • Protein p311
    • PTZ17
    • SEZ17
    see all
  • Function
    May have roles in neural function. Ectopic expression augments motility of gliomas. Promotes also axonal regeneration (By similarity). May also have functions in cellular differentiation (By similarity). Induces differentiation of fibroblast into myofibroblast and myofibroblast ameboid migration. Increases retinoic-acid regulation of lipid-droplet biogenesis.
  • Post-translational
    modifications
    Phosphorylated on Ser-59. Phosphorylation decreases stability and activity.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab160422 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160422 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160422.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up