Overview

  • Product name
    Recombinant Human P4HA1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MIWYILIIGILLPQSLAHPGFFTSIGQMTDLIHTEKDLVTSLKDYIKAEE DKLEQIKKWAEKLDRLTSTATKDPEGFVGHPVNAFKLMKRLNTEWSELEN LVLKDMSDGFISNLTIQRQYFPNDEDQVGAAKALLRLQDTYNLDTDTISK GNLPGVKHKSFLTAEDCFELGKVAYTEADYYHTELWMEQALRQLDEGEIS TIDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEY IMAKEKDVNKSASDDQSDQKTTPKKKGVAVDYLPERQKYEMLCRGEGIKM TPRRQKKLFCRYHDGNRNPKFILAPAKQEDEWDKPRIIRFHDIISDAEIE IVKDLAKPRLRRATISNPITGDLETVHYRISKSAWLSGYENPVVSRINMR IQDLTGLDVSTAEELQVANYGVGGQYEPHFDFARKDEPDAFKELGTGNRI ATWLFYMSDVSAGGATVFPEVGASVWPKKGTAVFWYNLFASGEGDYSTRH AACPVLVGNKWVSNKWLHERGQEFRRPCTLSELE
    • Molecular weight
      85 kDa including tags
    • Amino acids
      1 to 534

Specifications

Our Abpromise guarantee covers the use of ab114624 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • 2-oxoglutarate-4-dioxygenase subunit alpha-1
    • 4-hydroxylase, alpha I subunit
    • 4-PH alpha-1
    • P4HA
    • P4HA1
    • P4HA1_HUMAN
    • Procollagen-proline
    • Procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), alpha polypeptide I
    • Prolyl 4-hydroxylase subunit alpha-1
    see all
  • Function
    Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens and other proteins.
  • Sequence similarities
    Belongs to the P4HA family.
    Contains 1 Fe2OG dioxygenase domain.
    Contains 1 TPR repeat.
  • Cellular localization
    Endoplasmic reticulum lumen.
  • Information by UniProt

Recombinant Human P4HA1 protein images

  • ab114624 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human P4HA1 protein (ab114624)

ab114624 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114624.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up