Overview

  • Product name
    Recombinant Human P4HA2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKLWVSALLMAWFGVLSCVQAEFFTSIGHMTDLIYAEKELVQSLKEYILV EEAKLSKIKSWANKMEALTSKSAADAEGYLAHPVNAYKLVKRLNTDWPAL EDLVLQDSAAGFIANLSVQRQFFPTDEDEIGAAKALMRLQDTYRLDPGTI SRGELPGTKYQAMLSVDDCFGMGRSAYNEGDYYHTVLWMEQVLKQLDAGE EATTTKSQVLDYLSYAVFQLGDLHRALELTRRLLSLDPSHERAGGNLRYF EQLLEEEREKTLTNQTEAELATPEGIYERPVDYLPERDVYESLCRGEGVK LTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEWDSPHIVRYYDVMSDEEI ERIKEIAKPKLARATVRDPKTGVLTVASYRVSKSSWLEEDDDPVVARVNR RMQHITGLTVKTAELLQVANYGVGGQYEPHFDFSRRPFDSGLKTEGNRLA TFLNYMSDVEAGGATVFPDLGAAIWPKKGTAVFWYNLLRSGEGDYRTRHA ACPVLVGCKWVSNKWFHERGQEFLRPCGSTEVD
    • Amino acids
      1 to 533
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160278 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2-oxoglutarate-4-dioxygenase subunit alpha-2
    • 4 PH alpha 2
    • 4-PH alpha-2
    • C-P4Halpha(II)
    • collagen prolyl 4-hydroxylase alpha(II)
    • P4HA2
    • P4HA2_HUMAN
    • procollagen proline, 2 oxoglutarate 4 dioxygenase (proline 4 hydroxylase), alpha polypeptide II
    • procollagen proline, 2 oxoglutarate 4 dioxygenase alpha subunit, isoform 2
    • Procollagen-proline
    • procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-2
    • Prolyl 4 hydroxylase alpha 2 subunit
    • Prolyl 4 hydroxylase subunit alpha 2 [Precursor]
    • Prolyl 4-hydroxylase subunit alpha-2
    • Prolyl 4-hydroxylase, alpha polypeptide II
    see all
  • Function
    Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens and other proteins.
  • Sequence similarities
    Belongs to the P4HA family.
    Contains 1 Fe2OG dioxygenase domain.
    Contains 1 TPR repeat.
  • Cellular localization
    Endoplasmic reticulum lumen.
  • Information by UniProt

Images

  • ab160278 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160278 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160278.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up