Recombinant Human p57 Kip2 protein (ab112270)

Overview

  • Product nameRecombinant Human p57 Kip2 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP49918
    • SpeciesHuman
    • SequenceMSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARL AELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRC
    • Molecular weight37 kDa including tags
    • Amino acids1 to 100
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112270 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityuseful for Antibody Production and Protein Array
  • Applications

    Peptide Array

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • Beckwith Wiedemann syndrome
    • BWCR
    • BWS
    • CDKI
    • CDKN 1C
    • CDKN1C
    • CDN1C_HUMAN
    • Cyclin dependent kinase inhibitor 1C
    • Cyclin dependent kinase inhibitor p57
    • Cyclin-dependent kinase inhibitor 1C
    • Cyclin-dependent kinase inhibitor p57
    • KIP 2
    • KIP2
    • p57
    • p57 Kip 2
    • p57KIP2
    • WBS
    see all
  • FunctionPotent tight-binding inhibitor of several G1 cyclin/CDK complexes (cyclin E-CDK2, cyclin D2-CDK4, and cyclin A-CDK2) and, to lesser extent, of the mitotic cyclin B-CDC2. Negative regulator of cell proliferation. May play a role in maintenance of the non-proliferative state throughout life.
  • Tissue specificityExpressed in the heart, brain, lung, skeletal muscle, kidney, pancreas and testis. High levels are seen in the placenta while low levels are seen in the liver.
  • Involvement in diseaseDefects in CDKN1C are a cause of Beckwith-Wiedemann syndrome (BWS) [MIM:130650]. BWS is a genetically heterogeneous disorder characterized by anterior abdominal wall defects including exomphalos (omphalocele), pre- and postnatal overgrowth, and macroglossia. Additional less frequent complications include specific developmental defects and a predisposition to embryonal tumors.
    Note=Defects in CDKN1C are involved in tumor formation.
  • Sequence similaritiesBelongs to the CDI family.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human p57 Kip2 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human p57 Kip2 protein (ab112270)

ab112270 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112270.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"