Recombinant Human p60 CAF1 protein (ab159962)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWKVEKGP DGKAIVEFLSNLARHTKAVNVVRFSPTGEILASGGDDAVILLWKVNDNKE PEQIAFQDEDEAQLNKENWTVVKTLRGHLEDVYDICWATDGNLMASASVD NTAIIWDVSKGQKISIFNEHKSYVQGVTWDPLGQYVATLSCDRVLRVYSI QKKRVAFNVSKMLSGIGAEGEARSYRMFHDDSMKSFFRRLSFTPDGSLLL TPAGCVESGENVMNTTYVFSRKNLKRPIAHLPCPGKATLAVRCCPVYFEL RPVVETGVELMSLPYRLVFAVASEDSVLLYDTQQSFPFGYVSNIHYHTLS DISWSSDGAFLAISSTDGYCSFVTFEKDELGIPLKEKPVLNMRTPDTAKK TKSQTHRGSSPGPRPVEGTPASRTQDPSSPGTTPPQARQAPAPTVIRDPP SITPAVKSPLPGPSEEKTLQPSSQNTKAHPSRRVTLNTLQAWSKTTPRRI NLTPLKTDTPPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDEN KGGTESLDP
    • Amino acids
      1 to 559
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159962 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CAF 1 subunit B
    • CAF 1A
    • CAF I 60 kDa subunit
    • CAF IP60
    • CAF-1
    • CAF-1 subunit B
    • CAF-I 60 kDa subunit
    • CAF-I p60
    • CAF1
    • CAF1A
    • CAF1B_HUMAN
    • CAF1P60
    • CHAF 1B
    • CHAF1B
    • Chromatin assembly factor 1 subunit B
    • Chromatin assembly factor I
    • Chromatin assembly factor I p60 subunit
    • Human chromatin assembly factor-I p60 subunit
    • M phase phosphoprotein 7
    • M-phase phosphoprotein 7
    • MPHOSPH7
    • MPP 7
    • MPP7
    • p60 subunit
    see all
  • Function
    Complex that is thought to mediate chromatin assembly in DNA replication and DNA repair. Assembles histone octamers onto replicating DNA in vitro. CAF-1 performs the first step of the nucleosome assembly process, bringing newly synthesized histones H3 and H4 to replicating DNA; histones H2A/H2B can bind to this chromatin precursor subsequent to DNA replication to complete the histone octamer. The CCR4-NOT complex functions as general transcription regulation complex.
  • Sequence similarities
    Belongs to the WD repeat HIR1 family.
    Contains 7 WD repeats.
  • Developmental stage
    Active complex is found in G1, S and G2 phases.
  • Post-translational
    modifications
    Differentially phosphorylated during cell cycle. During mitosis the p60 subunit of inactive CAF-1 is hyperphosphorylated and displaced into the cytosol. Progressivly dephosphorylated from G1 to S and G2 phase. Phosphorylated p60 is recruited to chromatin undergoing DNA repair after UV irradiation in G1, S or G2 phases.
  • Cellular localization
    Nucleus. Cytoplasm. DNA replication foci. Cytoplasmic in M phase.
  • Information by UniProt

Images

  • ab159962 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159962 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159962.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up