Recombinant Human p66 beta protein (ab153450)

Overview

  • Product name
    Recombinant Human p66 beta protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKMLALLKRK DLANLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENIND EPVDMSAR
    • Amino acids
      3 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153450 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ37346
    • GATA zinc finger domain containing 2B
    • GATA zinc finger domain containing protein 2B
    • GATA zinc finger domain-containing protein 2B
    • GATAD2B
    • KIAA1150
    • MGC138257
    • MGC138285
    • mKIAA1150
    • p66/p68
    • P66B_HUMAN
    • P66beta
    • RGD1308533
    • transcription repressor p66 beta component of the MeCP1 complex
    • Transcriptional repressor p66 beta
    • Transcriptional repressor p66-beta
    see all
  • Function
    Has transcriptional repressor activity. Targets MBD3 to discrete loci in the nucleus.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Contains 1 GATA-type zinc finger.
  • Domain
    CR1 is required for interaction with MBD3 and transcription repression.
    CR2 is required for localization to discrete loci in the nucleus.
  • Cellular localization
    Nucleus. Nuclear, in discrete foci.
  • Information by UniProt

Images

  • ab153450 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153450 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153450.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up