Recombinant Human p73 alpha protein (ab101716)

Overview

  • Product nameRecombinant Human p73 alpha protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceBaculovirus
  • Amino Acid Sequence
    • AccessionO15350
    • SpeciesHuman
    • SequenceMAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMD VFHLEGMTTSVMAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYA QPSSTFDTMSPAPVIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKK LYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELG RDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFT TILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGR DRKADEDHYREQQALNESSAKNGAASKRAFKQSPPAVPALGAGVKKRRHG DEDTYYLQVRGRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQRPS HLQPPSYGPVLSPMNKVHGGMNKLPSVNQLVGQPPPHSSAATPNLGPVGP GMLNNHGHAVPANGEMSSSHSAQSMVSGSHCTPPPPYHADPSLVSFLTGL GCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMTIWRGLQDLKQ GHDYSTAQQLLRSSNAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRG GPGGGPDEWADFGFDLPDCKARKQPIKEEFTEAEIH
    • Molecular weight110 kDa including tags
    • Amino acids1 to 636

Specifications

Our Abpromise guarantee covers the use of ab101716 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 25% Glycerol, 50mM Tris HCl, 150mM Sodium chloride, 10mM Glutathione, 0.25mM DTT, 0.1mM EDTA, 0.1mM PMSF, pH 7.5

General Info

  • Alternative names
    • p53 like transcription factor
    • p53 related protein p73
    • p53-like transcription factor
    • p53-related protein
    • P73
    • P73_HUMAN
    • TP73
    • Tumor protein p73
    see all
  • FunctionParticipates in the apoptotic response to DNA damage. Isoforms containing the transactivation domain are pro-apoptotic, isoforms lacking the domain are anti-apoptotic and block the function of p53 and transactivating p73 isoforms. May be a tumor suppressor protein.
  • Tissue specificityExpressed in striatal neurons of patients with Huntington disease (at protein level). Brain, kidney, placenta, colon, heart, liver, spleen, skeletal muscle, prostate, thymus and pancreas. Highly expressed in fetal tissue.
  • Sequence similaritiesBelongs to the p53 family.
    Contains 1 SAM (sterile alpha motif) domain.
  • DomainPossesses an acidic transactivation domain, a central DNA binding domain and a C-terminal oligomerization domain that binds to the ABL tyrosine kinase SH3 domain.
    The WW-binding motif mediates interaction with WWOX.
  • Post-translational
    modifications
    Isoform alpha (but not isoform beta) is sumoylated on Lys-627, which potentiates proteasomal degradation but does not affect transcriptional activity.
    Higher levels of phosphorylation seen in the brain from patients with Huntington disease.
    Ubiquitinated; leading to its degradation by the proteasome.
  • Cellular localizationNucleus. Accumulates in the nucleus in response to DNA damage.
  • Information by UniProt

Recombinant Human p73 alpha protein images

  • The putity of ab101716 was determined to be 90% by densitometry.

    Approximate MWt: 110kDa

References for Recombinant Human p73 alpha protein (ab101716)

ab101716 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101716.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"