Recombinant Human PABPC1L2A protein (ab166282)

Overview

  • Product name
    Recombinant Human PABPC1L2A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASLYVGDLHPEVTEAMLYEKFSPAGPILSIRICRDKITRRSLGYAYVNY QQPVDAKRALETLNFDVIKGRPVRIMWSQRDPSLRKSGVGNVFIKNLGKT IDNKALYNIFSAFGNILSCKVACDEKGPKGYGFVHFQKQESAERAIDVMN GMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTDEEATLR
    • Amino acids
      1 to 200
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166282 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PABPC1L2
    • PABPC1L2A
    • PABPC1L2B
    • PAP1M_HUMAN
    • Poly(A) binding protein, cytoplasmic 1 like 2A
    • Polyadenylate binding protein 1 like 2
    • Polyadenylate-binding protein 1-like 2
    • RBM32A
    • RBM32B
    • RNA binding motif protein 32
    • RNA binding protein 32
    • RNA-binding motif protein 32
    • RNA-binding protein 32
    • RP11-493K23.3
    see all
  • Sequence similarities
    Contains 2 RRM (RNA recognition motif) domains.
  • Information by UniProt

Images

  • ab166282 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166282 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166282.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up