Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDSYSRY RKQMAVKKYLAAVLGKRYKQRVKNKGRR
    • Amino acids
      95 to 172
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157855 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • adenylate cyclase activating polypeptide 1
    • adenylate cyclase activating polypeptide 1 (pituitary)
    • PACAP
    • PACAP-related peptide
    • Pituitary adenylate cyclase-activating polypeptide
    • Pituitary adenylate cyclase-activating polypeptide 27
    • Pituitary adenylate cyclase-activating polypeptide 38
    • prepro-PACAP
    • PRP-48
    see all
  • Relevance
    Adenylate cyclase activating polypeptide, mediated by adenylate cyclase activating polypeptide 1 receptors, stimulates adenylate cyclase and subsequently increases the cAMP level in target cells. Adenylate cyclase activating polypeptide 1 is not only a hypophysiotropic hormone, but also functions as a neurotransmitter and neuromodulator. In addition, it plays a role in paracrine and autocrine regulation of certain types of cells. The gene encodes three different mature peptides, including two isotypes: a shorter form and a longer form.
  • Cellular localization
    Secreted

Images

  • ab157855 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157855 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157855.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up