Recombinant Human PACAP receptor protein (ab114647)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP41586
    • SpeciesHuman
    • SequenceMHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVG EMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTE
    • Molecular weight37 kDa including tags
    • Amino acids21 to 120

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114647 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADCYAP1 R1
    • ADCYAP1R 1
    • ADCYAP1R1
    • Adenylate cyclase activating polypeptide 1 (pituitary) receptor type 1
    • Adenylate cyclase activating polypeptide 1 (pituitary) receptor type I
    • PAC 1
    • PAC1
    • PAC1R
    • PACAP receptor 1
    • PACAP type I receptor
    • PACAP-R-1
    • PACAP-R1
    • PACAP1 R
    • PACAPR
    • PACAPRI
    • PACR_HUMAN
    • Pituitary adenylate cyclase activating polypeptide 1 receptor type I Hiphop
    • Pituitary adenylate cyclase activating polypeptide receptor
    • Pituitary adenylate cyclase activating polypeptide type I receptor precursor
    • Pituitary adenylate cyclase-activating polypeptide 1, receptor for
    • Pituitary adenylate cyclase-activating polypeptide type I receptor
    • pvr1
    see all
  • FunctionThis is a receptor for PACAP-27 and PACAP-38. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. May regulate the release of adrenocorticotropin, luteinizing hormone, growth hormone, prolactin, epinephrine, and catecholamine. May play a role in spermatogenesis and sperm motility. Causes smooth muscle relaxation and secretion in the gastrointestinal tract.
  • Tissue specificityMost abundant in the brain, low expression in the lung, liver, thymus, spleen, pancreas and placenta.
  • Sequence similaritiesBelongs to the G-protein coupled receptor 2 family.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human PACAP receptor protein images

  • ab114647 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human PACAP receptor protein (ab114647)

ab114647 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114647.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"