Recombinant Human PACT (PKR activating protein) / PRKRA (ab152895)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ANASICFAVPDPLMPDPSKQPKNQLNPIGSLQELAIHHGWRLPEYTLSQE GGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLAKFSNISPENH
    • Molecular weight
      37 kDa including tags
    • Amino acids
      101 to 200

Specifications

Our Abpromise guarantee covers the use of ab152895 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DYT16
    • HSD14
    • Interferon inducible double stranded RNA dependent protein kinase activator A
    • interferon-inducible double stranded RNA-dependent activator
    • Interferon-inducible double stranded RNA-dependent protein kinase activator A
    • PACT
    • PKR associated protein X
    • PKR associating protein X
    • PKR-associated protein X
    • PKR-associating protein X
    • PRKRA
    • PRKRA_HUMAN
    • Protein activator of the interferon induced protein kinase
    • Protein activator of the interferon-induced protein kinase
    • Protein kinase
    • Protein kinase interferon inducible double stranded RNA dependent activator
    • RAX
    see all
  • Function
    Activates EIF2AK2/PKR in the absence of double stranded RNA (dsRNA), leading to phosphorylation of EIF2S1/EFI2-alpha and inhibition of translation and induction of apoptosis. Required for siRNA production by DICER1 and for subsequent siRNA-mediated post-transcriptional gene silencing. Does not seem to be required for processing of pre-miRNA to miRNA by DICER1.
  • Involvement in disease
    Defects in PRKRA are the cause of dystonia type 16 (DYT16) [MIM:612067]. DYT16 is an early-onset dystonia-parkinsonism disorder. Dystonia is defined by the presence of sustained involuntary muscle contraction, often leading to abnormal postures. DYT16 patients have progressive, generalized dystonia with axial muscle involvement, oro-mandibular (sardonic smile) and laryngeal dystonia and, in some cases, parkinsonian features.
  • Sequence similarities
    Belongs to the PRKRA family.
    Contains 3 DRBM (double-stranded RNA-binding) domains.
  • Domain
    Self-association may occur via interactions between DRBM domains as follows: DRBM 1/DRBM 1, DRBM 1/DRBM 2, DRBM 2/DRBM 2 or DRBM 3/DRBM3.
  • Post-translational
    modifications
    Phosphorylated at Ser-246 in unstressed cells and at Ser-287 in stressed cells. Phosphorylation at Ser-246 appears to be a prerequisite for subsequent phosphorylation at Ser-287. Phosphorylation at Ser-246 and Ser-287 are necessary for activation of EIF2AK2/PKR under conditions of stress.
  • Cellular localization
    Cytoplasm > perinuclear region.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152895 stained with Coomassie Blue.

References

ab152895 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152895.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up