Recombinant Human PACT (PKR activating protein) / PRKRA (ab183223)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMSQSRHRAEAPPLEREDSGTFSLGKMI TAKPGKTPIQVLHEYGMKTKNIPVYECERSDVQIHVPTFTFRVTVGDITC TGEGTSKKLAKHRAAEAAINILKANASICFAVPDPLMPDPSKQPKNQLNP IGSLQELAIHHGWRLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASK KQAKRNAAEKFLAKFSNISPENHISLTNVVGHSLGCTWHSLRNSPGEKIN LLKRSLLSIPNTDYIQLLSEIAKEQGFNITYLDIDELSANGQYQCLAELS TSPITVCHGSGISCGNAQSDAAHNALQYLKIIAERK
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 313
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_003681

Specifications

Our Abpromise guarantee covers the use of ab183223 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 80 % SDS-PAGE.
    ab183223 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 1.17% Sodium chloride, 0.03% EDTA, 0.03% DTT, 50% Glycerol

General Info

  • Alternative names
    • DYT16
    • HSD14
    • Interferon inducible double stranded RNA dependent protein kinase activator A
    • interferon-inducible double stranded RNA-dependent activator
    • Interferon-inducible double stranded RNA-dependent protein kinase activator A
    • PACT
    • PKR associated protein X
    • PKR associating protein X
    • PKR-associated protein X
    • PKR-associating protein X
    • PRKRA
    • PRKRA_HUMAN
    • Protein activator of the interferon induced protein kinase
    • Protein activator of the interferon-induced protein kinase
    • Protein kinase
    • Protein kinase interferon inducible double stranded RNA dependent activator
    • RAX
    see all
  • Function
    Activates EIF2AK2/PKR in the absence of double stranded RNA (dsRNA), leading to phosphorylation of EIF2S1/EFI2-alpha and inhibition of translation and induction of apoptosis. Required for siRNA production by DICER1 and for subsequent siRNA-mediated post-transcriptional gene silencing. Does not seem to be required for processing of pre-miRNA to miRNA by DICER1.
  • Involvement in disease
    Defects in PRKRA are the cause of dystonia type 16 (DYT16) [MIM:612067]. DYT16 is an early-onset dystonia-parkinsonism disorder. Dystonia is defined by the presence of sustained involuntary muscle contraction, often leading to abnormal postures. DYT16 patients have progressive, generalized dystonia with axial muscle involvement, oro-mandibular (sardonic smile) and laryngeal dystonia and, in some cases, parkinsonian features.
  • Sequence similarities
    Belongs to the PRKRA family.
    Contains 3 DRBM (double-stranded RNA-binding) domains.
  • Domain
    Self-association may occur via interactions between DRBM domains as follows: DRBM 1/DRBM 1, DRBM 1/DRBM 2, DRBM 2/DRBM 2 or DRBM 3/DRBM3.
  • Post-translational
    modifications
    Phosphorylated at Ser-246 in unstressed cells and at Ser-287 in stressed cells. Phosphorylation at Ser-246 appears to be a prerequisite for subsequent phosphorylation at Ser-287. Phosphorylation at Ser-246 and Ser-287 are necessary for activation of EIF2AK2/PKR under conditions of stress.
  • Cellular localization
    Cytoplasm > perinuclear region.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab183223 (3μg).

References

ab183223 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab183223.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up