Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSAAASFGQTKIPRGNGPYSVGCTDLMFD HTNKGTFLRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNILRL LFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHGFI VAAVEHRDRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVR QRAKECSQALSLILDIDHGKPVKNALDLKFDMEQLKDSIDREKIAVIGHS FGGATVIQTLSEDQRFRCGIALDAWMFPLGDEVYSRIPQPLFFINSEYFQ YPANIIKMKKCYSPDKERKMITIRGSVHQNFADFTFATGKIIGHMLKLKG DIDSNVAIDLSNKASLAFLQKHLGLHKDFDQWDCLIEGDDENLIPGTNIN TTNQHIMLQNSSGIEKYN
    • Molecular weight
      47 kDa including tags
    • Amino acids
      47 to 441
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_001161829

Specifications

Our Abpromise guarantee covers the use of ab187612 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab187612 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names
    • Platelet-activating factor acetylhydrolase precursor
    • 1 alkyl 2 acetylglycerophosphocholine esterase
    • 1-alkyl-2-acetylglycerophosphocholine esterase
    • 2 acetyl 1 alkylglycerophosphocholine esterase
    • 2-acetyl-1-alkylglycerophosphocholine esterase
    • EC 3.1.1.47 PAF acetylhydrolase PAF 2-acylhydrolase LDL associated phospholipase A2
    • Group VIIA phospholipase A2
    • Group-VIIA phospholipase A2
    • gVIIA PLA2
    • gVIIA-PLA2
    • LDL associated phospholipase A2
    • LDL PLA(2)
    • LDL PLA2
    • LDL-associated phospholipase A2
    • LDL-PLA(2)
    • Lipoprotein associated phospholipase A2
    • LP PLA2
    • PAF 2 acylhydrolase
    • PAF 2 acylhydrolase LDL associated phospholipase A2
    • PAF 2-acylhydrolase
    • PAF acetylhydrolase
    • PAFA_HUMAN
    • PAFAD
    • PAFAH
    • Phospholipase A2, group VII (platelet activating factor acetylhydrolase, plasma)
    • PLA2G7
    • Platelet activating factor acetylhydrolase
    • Platelet activating factor acetylhydrolase 2
    • Platelet-activating factor acetylhydrolase
    see all
  • Function
    Modulates the action of platelet-activating factor (PAF) by hydrolyzing the sn-2 ester bond to yield the biologically inactive lyso-PAF. Has a specificity for substrates with a short residue at the sn-2 position. It is inactive against long-chain phospholipids.
  • Tissue specificity
    Plasma.
  • Involvement in disease
    Platelet-activating factor acetylhydrolase deficiency
    Asthma
    Atopic hypersensitivity
  • Sequence similarities
    Belongs to the AB hydrolase superfamily. Lipase family.
  • Cellular localization
    Secreted, extracellular space.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab187612 (3 μg).

References

ab187612 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187612.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up