Recombinant Human PAFAH1B3 protein (ab114916)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ15102
    • SpeciesHuman
    • SequenceMSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQ LMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVW VGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLRE KNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLG YTPVCRALHSLLLRLLAQDQGQGAPLLEPAP
    • Molecular weight52 kDa including tags
    • Amino acids1 to 231

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114916 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PA1B3_HUMAN
    • PAF acetylhydrolase 29 kDa subunit
    • PAF AH 29 kDa subunit
    • PAF AH subunit gamma
    • PAF-AH 29 kDa subunit
    • PAF-AH subunit gamma
    • PAFAH subunit gamma
    • Pafah1b3
    • PAFAHG
    • Platelet activating factor acetylhydrolase IB subunit gamma
    • Platelet activating factor acetylhydrolase isoform Ib gamma subunit
    • Platelet activating factor acetylhydrolase isoform Ib gamma subunit (29kD)
    • Platelet activating factor acetylhydrolase isoform Ib gamma subunit 29kDa
    • Platelet-activating factor acetylhydrolase IB subunit gamma
    see all
  • FunctionInactivates paf by removing the acetyl group at the sn-2 position. This is a catalytic subunit. Plays an important role during the development of brain.
  • Tissue specificityIn the adult, expressed in brain, skeletal muscle, kidney, thymus, spleen, colon, testis, ovary and peripheral blood leukocytes. In the fetus, highest expression occurs in brain.
  • Sequence similaritiesBelongs to the 'GDSL' lipolytic enzyme family. Platelet-activating factor acetylhydrolase IB beta/gamma subunits subfamily.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human PAFAH1B3 protein images

  • 12.5% SDS-PAGE showing ab114916 at approximately 51.52kDa.
    Stained with Coomassie Blue.

References for Recombinant Human PAFAH1B3 protein (ab114916)

ab114916 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114916.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"