Recombinant Human PAFAH1B3 protein (ab114916)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQ LMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVW VGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLRE KNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLG YTPVCRALHSLLLRLLAQDQGQGAPLLEPAP
    • Molecular weight
      52 kDa including tags
    • Amino acids
      1 to 231

Specifications

Our Abpromise guarantee covers the use of ab114916 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PA1B3_HUMAN
    • PAF acetylhydrolase 29 kDa subunit
    • PAF AH 29 kDa subunit
    • PAF AH subunit gamma
    • PAF-AH 29 kDa subunit
    • PAF-AH subunit gamma
    • PAFAH subunit gamma
    • Pafah1b3
    • PAFAHG
    • Platelet activating factor acetylhydrolase IB subunit gamma
    • Platelet activating factor acetylhydrolase isoform Ib gamma subunit
    • Platelet activating factor acetylhydrolase isoform Ib gamma subunit (29kD)
    • Platelet activating factor acetylhydrolase isoform Ib gamma subunit 29kDa
    • Platelet-activating factor acetylhydrolase IB subunit gamma
    see all
  • Function
    Inactivates paf by removing the acetyl group at the sn-2 position. This is a catalytic subunit. Plays an important role during the development of brain.
  • Tissue specificity
    In the adult, expressed in brain, skeletal muscle, kidney, thymus, spleen, colon, testis, ovary and peripheral blood leukocytes. In the fetus, highest expression occurs in brain.
  • Sequence similarities
    Belongs to the 'GDSL' lipolytic enzyme family. Platelet-activating factor acetylhydrolase IB beta/gamma subunits subfamily.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114916 at approximately 51.52kDa.
    Stained with Coomassie Blue.

References

ab114916 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114916.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up