Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPDQISVSEFVAETHEDYKAPTASSFTTRTAQCRNTVAAIEEALDVDRMV LYKMKKSVKAINSSGLAHVENEEQYTQALEKFGGNCVCRDDPDLGSAFLK FSVFTKELTALFKNLIQNMNNIISFPLDSLLKGDLKGVKGDLKKPFDKAW KDYETKITKIEKEKKEHAKLHGMIRTEISGAEIAEEMEKERRFFQLQMCE YLLKVNEIKIKKGVDLLQNLIKYFHAQCNFFQDGLKAVESLKPSIETLST DLHTIKQAQDEERRQLIQLRDILKSALQVEQKEDSQIRQSTAYSLHQPQG NKEHGTERNGSLYKKSDGIRKVWQKRKCSVKNGFLTISHGTANRPPAKLN LLTCQVKTNPEEKKCFDLISHDRTYHFQAEDEQECQIWMSVLQNSKEEAL NNAFKGDDNTGENNIVQELTKEIISEVQRMTGNDVCCDCGAPDPTWLSTN LGILTCIECSGIHRELGVHYSRMQSLTLDVLGTSELLLAKNIGNAGFNEI MECCLPAEDSVKPNPGSDMNARKDYITAKYIERRYARKKHADNAAKLHSL CEAVKTRDIFGLLQAYADGVDLTEKIPLANGHEPDETALHLAVRSVDRTS LHIVDFLVQNSGNLDKQTGKGSTALHYCCLTDNAECLKLLLRGKASIEIA NESGETPLDIAKRLKHEHCEELLTQALSGRFNSHVHVEYEWRLLHEDLDE SDDDMDEKLQPSPNRREDRPISFYQLGSNQLQSNAVSLARDAANLAKEKQ RAFMPSILQNETYGALLSGSPPPAQPAAPSTTSAPPLPPRNVGKVQTASS ANTLWKTNSVSVDGGSRQRSSSDPPAVHPPLPPLRVTSTNPLTPTPPPPV AKTPSVMEALSQPSKPAPPGISQIRPPPLPPQPPSRLPQKKPAPGADKST PLTNKGQPRGPVDLSATEALGPLSNAMVLQPPAPMPRKSQATKLKPKRVK ALYNCVADNPDELTFSEGDVIIVDGEEDQEWWIGHIDGDPGRKGAFPVSF VHFIAD
    • Amino acids
      1 to 1006
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160224 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AMAP 2
    • AMAP2
    • ANK repeat and PH domain-containing protein 2
    • Arf-GAP with SH3 domain
    • ArfGAP with SH3 domain, ankyrin repeat and PH domain 2
    • ASAP2
    • ASAP2_HUMAN
    • centaurin, beta 3
    • CENTB3
    • DDEF 2
    • DDEF2
    • Development and differentiation enhancing factor 2
    • Development and differentiation-enhancing factor 2
    • FLJ42910
    • KIAA0400
    • PAG 3
    • PAG3
    • PAP
    • Pap alpha
    • Paxillin associated protein with ARFGAP activity 3
    • Paxillin-associated protein with ARF GAP activity 3
    • Pyk2 C terminus associated protein
    • Pyk2 C-terminus-associated protein
    • SHAG 1
    • SHAG1
    see all
  • Function
    Activates the small GTPases ARF1, ARF5 and ARF6. Regulates the formation of post-Golgi vesicles and modulates constitutive secretion. Modulates phagocytosis mediated by Fc gamma receptor and ARF6. Modulates PXN recruitment to focal contacts and cell migration.
  • Tissue specificity
    Detected in heart, brain, placenta, kidney, monocytes and pancreas.
  • Sequence similarities
    Contains 2 ANK repeats.
    Contains 1 Arf-GAP domain.
    Contains 1 PH domain.
    Contains 1 SH3 domain.
  • Domain
    The conserved Arg-464 in the Arf-GAP domain probably becomes part of the active site of bound small GTPases and is necessary for GTP hydrolysis.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residues by SRC and PTK2B.
  • Cellular localization
    Cytoplasm. Golgi apparatus > Golgi stack membrane. Cell membrane. Colocalizes with F-actin and ARF6 in phagocytic cups.
  • Information by UniProt

Images

  • ab160224 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160224 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160224.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up