Recombinant Human PAG608 protein (ab167842)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMILLQHAVLPPPKQPSPSPPMSVATRS TGTLQLPPQKPFGQEASLPLAGEEELSKGGEQDCALEELCKPLYCKLCNV TLNSAQQAQAHYQGKNHGKKLRNYYAANSCPPPARMSNVVEPAATPVVPV PPQMGSFKPGGRVILATENDYCKLCDASFSSPAVAQAHYQGKNHAKRLRL AEAQSNSFSESSELGQRRARKEGNEFKMMPNRRNMYTVQNNSAGPYFNPR SRQRIPRDLAMCVTPSGQFYCSMCNVGAGEEMEFRQHLESKQHKSKVSEQ RYRNEMENLGYV
    • Molecular weight
      34 kDa including tags
    • Amino acids
      1 to 289
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167842 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab167842 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.03% DTT, 0.32% Tris HCl, 50% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • FLJ12296
    • FLJ31683
    • MGC10613
    • OTTHUMP00000211906
    • OTTHUMP00000211907
    • p53 activated gene 608
    • p53 inducible zinc finger protein
    • p53 target zinc finger protein
    • p53-activated gene 608 protein
    • PAG 608
    • WIG 1
    • WIG 1/PAG608 protein
    • WIG1
    • WIG1/PAG608 protein
    • Wildtype p53-induced gene
    • Zinc finger matrin type 3
    • Zinc finger matrin-type protein 3
    • Zinc finger protein WIG 1
    • Zinc finger protein WIG-1
    • Zinc finger protein WIG1
    • ZMAT 3
    • Zmat3
    • ZMAT3_HUMAN
    see all
  • Function
    Acts as a bona fide target gene of p53/TP53. May play a role in the TP53-dependent growth regulatory pathway. May contribute to TP53-mediated apoptosis by regulation of TP53 expression and translocation to the nucleus and nucleolus.
  • Tissue specificity
    Highly expressed in adult brain, and moderately in adult kidney and testis. Not detected in fetal brain, heart, pancreas, adrenal gland, liver or small intestine.
  • Sequence similarities
    Contains 3 matrin-type zinc fingers.
  • Cellular localization
    Nucleus. Nucleus > nucleolus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab167842 (3µg).

References

ab167842 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167842.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up