Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YPTLSEYVQDFLNHLTEQPGSFETEIEQFAETLNGCVTTDDALQELVELI YQQATSIPNFSYMGARLCNYLSHHLTISPQSGNFRQLLLQRCRTEYEVKD QAAKGDEVTR
    • Amino acids
      76 to 185
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161064 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC12360
    • OTTHUMP00000221601
    • OTTMUSP00000026880
    • PABC1 interacting protein 1
    • PABP interacting protein 1
    • PABP-interacting protein 1
    • PAIP 1
    • PAIP-1
    • Paip1
    • PAIP1_HUMAN
    • Poly(A) binding protein interacting protein 1
    • Poly(A)-binding protein-interacting protein 1
    • Polyadenylate binding protein interacting protein 1
    • Polyadenylate-binding protein-interacting protein 1
    see all
  • Function
    Acts as a coactivator in the regulation of translation initiation of poly(A)-containing mRNAs. Its stimulatory activity on translation is mediated via its action on PABPC1. Competes with PAIP2 for binding to PABPC1. Its association with EIF4A and PABPC1 may potentiate contacts between mRNA termini. May also be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain.
  • Sequence similarities
    Contains 1 MIF4G domain.
  • Domain
    Only the PABPC1-interacting motif-1 (PAM1) stimulates translation initiation.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab161064 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161064 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161064.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up