Recombinant Human PAK1 interacting protein 1 (ab162927)

Overview

  • Product name
    Recombinant Human PAK1 interacting protein 1
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MELVAGCYEQVLFGFAVHPEPEACGDHEQWTLVADFTHHAHTASLSAVAV NSRFVVTGSKDETIHIYDMKKKIEHGALVHHSGTITCLKFYGNRHLISGA EDGLICIWDAKKWECLKSIKAHKGQVTFLSIHPSGKLALSVGTDKTLRTW NLVEGRSAFIKNIKQNAHIVEWSPRGEQYVVIIQNKIDIYQLDTASISGT VTNEKRISSVKFLSESVLAVAGDEEVIRFFDCDSLVCLCEFKAHENRVKD MFSFEIPEHHVIVSASSDGFIKMWKLEQDKKVPPSLLCEINTNARLTCLG VWLDKVADMKESLPPAAEPSPVSKEQSKIGKKEPGDTVHKEEKRSKPNTK KRGLTGDSKKATKESGLISTKKRKMVEMLEKKRKKKKIKTMQ
    • Amino acids
      1 to 392
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162927 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bA421M1.5
    • FLJ20624
    • hPIP 1
    • hPIP1
    • MAK 11
    • MAK11
    • p21 activated protein kinase interacting protein 1
    • PAK- AND PLC-INTERACTING PROTEIN 1
    • PAK/PLC interacting protein 1
    • PAK1 interacting protein
    • PAK1IP1
    • PIP 1
    • PIP1
    • Putative PAK inhibitor Skb15
    • RP11 421M1.5
    • WD repeat containing protein 84
    • WDR 84
    • WDR84
    see all
  • Relevance
    PAK1 interacting protein 1 (PAK1IP1) negatively regulates the PAK1 kinase. PAK1 is a member of the PAK kinase family, which have been shown to play a positive role in the regulation of signaling pathways involving MAPK8 and RELA. PAK1 exists as an inactive homodimer, which is activated by binding of small GTPases such as CDC42 to an N terminal regulatory domain. PAK1IP1 also binds to the N terminus of PAK1, and inhibits the specific activation of PAK1 by CDC42.
  • Cellular localization
    Nuclear, nucleolus.

Images

  • ab162927 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162927 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162927.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up