Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP19021
    • SpeciesHuman
    • SequenceFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPLIAGMY LMMSVDTVIPAGEKVVNSDISCHYKNYPMHVFAYRVHTHHLGKVVSGYRV RNGQWTLI
    • Molecular weight38 kDa including tags
    • Amino acids151 to 258

Specifications

Our Abpromise guarantee covers the use of ab116776 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AMD_HUMAN
    • PAL
    • PAM
    • Pancreatic peptidylglycine alpha amidating monooxygenase
    • Peptidyl alpha amidating enzyme
    • Peptidyl alpha hydroxyglycine alpha amidating lyase
    • Peptidyl-alpha-hydroxyglycine alpha-amidating lyase
    • Peptidylamidoglycolate lyase
    • Peptidylglycine 2 hydroxylase
    • Peptidylglycine alpha amidating monooxygenase
    • Peptidylglycine alpha hydroxylating monooxygenase
    • PHM
    see all
  • FunctionBifunctional enzyme that catalyzes 2 sequential steps in C-terminal alpha-amidation of peptides. The monooxygenase part produces an unstable peptidyl(2-hydroxyglycine) intermediate that is dismutated to glyoxylate and the corresponding desglycine peptide amide by the lyase part. C-terminal amidation of peptides such as neuropeptides is essential for full biological activity.
  • Sequence similaritiesIn the C-terminal section; belongs to the peptidyl-alpha-hydroxyglycine alpha-amidating lyase family.
    In the N-terminal section; belongs to the copper type II ascorbate-dependent monooxygenase family.
    Contains 5 NHL repeats.
  • Cellular localizationMembrane and Secreted. Secreted from secretory granules.
  • Information by UniProt

Recombinant Human PAM protein images

  • 12.5% SDS-PAGE showing ab116776 at approximately 37.51kDa.
    Stained with Coomassie Blue.

References for Recombinant Human PAM protein (ab116776)

ab116776 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116776.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"