Overview

  • Product name
    Recombinant Human PAMR1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MELGCWTQLGLTFLQLLLISSLPREYTVINEACPGAEWNIMCRECCEYDQ IECVCPGKREVVGYTIPCCRNEENECDSCLIHPGCTIFENCKSCRNGSWG GTLDDFYVKGFYCAECRAGWYGGDCMRCGQVLRAPKGQILLESYPLNAHC EWTIHAKPGFVIQLRFVMLSLEFDYMCQYDYVEVRDGDNRDGQIIKRVCG NERPAPIQSIGSSLHVLFHSDGSKNFDGFHAIYEEITACSSSPCFHDGTC VLDKAGSYKCACLAGYTGQRCENLLEAGKSKIKASEDSLSVLEERNCSDP GGPVNGYQKITGGPGLINGRHAKIGTVVSFFCNNSYVLSGNEKRTCQQNG EWSGKQPICIKACREPKISDLVRRRVLPMQVQSRETPLHQLYSAAFSKQK LQSAPTKKPALPFGDLPMGYQHLHTQLQYECISPFYRRLGSSRRTCLRTG KWSGRAPSCIPICGKIENITAPKTQGLRWPWQAAIYRRTSGVHDGSLHKG AWFLVCSGALVNERTVVVAAHCVTDLGKVTMIKTADLKVVLGKFYRDDDR DEKTIQSLQISAIILHPNYDPILLDADIAILKLLDKARISTRVQPICLAA SRDLSTSFQESHITVAGWNVLADVRSPGFKNDTLRSGVVSVVDSLLCEEQ HEDHGIPVSVTDNMFCASWEPTAPSDICTAETGGIAAVSFPGRASPEPRW HLMGLVSWSYDKTCSHRLSTAFTKVLPFKDWIERNMK
    • Amino acids
      1 to 737
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161825 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZP586H2123
    • FP938
    • Inactive serine protease
    • Inactive serine protease PAMR1
    • Inactive serine protease RAMP
    • PAMR 1
    • PAMR1
    • PAMR1_HUMAN
    • Peptidase domain containing associated with muscle regeneration 1
    • Peptidase domain-containing protein associated with muscle regeneration 1
    • RAMP
    • Regeneration associated muscle protease
    • Regeneration associated muscle protease homolog
    • Regeneration-associated muscle protease homolog
    see all
  • Function
    May play a role in regeneration of skeletal muscle.
  • Sequence similarities
    Belongs to the peptidase S1 family.
    Contains 1 CUB domain.
    Contains 1 EGF-like domain.
    Contains 1 peptidase S1 domain.
    Contains 2 Sushi (CCP/SCR) domains.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab161825 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161825 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161825.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up