Overview

  • Product name
    Recombinant Human Pan2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TVYLFHMPRKRMISLRFLAWYFLDLKIQGETHDSIEDARTALQLYRKYLE LSKNGTEPESFHKVLKGLYEKGRKMDWKVPEPEGQTSPKNAAVFSSVLAL
    • Amino acids
      1099 to 1198
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160718 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hPan2
    • Inactive ubiquitin carboxyl terminal hydrolase 52
    • Inactive ubiquitin carboxyl-terminal hydrolase 52
    • KIAA0710
    • PAB dependent poly(A) specific ribonuclease subunit 2
    • PAB-dependent poly(A)-specific ribonuclease subunit 2
    • PABP dependent poly(A) nuclease 2
    • PAN 2
    • PAN2
    • PAN2 homolog PABP1 dependent poly A specific ribonuclease subunit
    • PAN2 poly(A) specific ribonuclease subunit homolog
    • PAN2 polyA specific ribonuclease subunit homolog
    • PAN2_HUMAN
    • Ubiquitin specific peptidase 52
    • Ubiquitin specific protease 52
    • USP 52
    • USP52
    see all
  • Function
    Functions in cytoplasmic mRNA decay. As part of the Pan nuclease complex, shortens poly(A) tails of RNA when the poly(A) stretch is bound by polyadenylate-binding protein.
  • Sequence similarities
    Belongs to the peptidase C19 family. PAN2 subfamily.
    Contains 1 exonuclease domain.
  • Cellular localization
    Cytoplasm. Nucleus. Shuttles between nucleus and cytoplasm.
  • Information by UniProt

Images

  • ab160718 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160718 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160718.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up