Recombinant Human Pancreatic Lipase protein (ab114950)

Overview

  • Product name
    Recombinant Human Pancreatic Lipase protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MLPLWTLSLLLGAVAGKEVCYERLGCFSDDSPWSGITERPLHILPWSPKD VNTRFLLYTNENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEE NWLANVCKNLFKVESVNCICVDWKGGSRTGYTQASQNIRIVGAEVAYFVE FLQSAFGYSPSNVHVIGHSLGAHAAGEAGRRTNGTIGRITGLDPAEPCFQ GTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGHLDFFPNGGVE MPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGF PCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDAS NFARWRYKVSVTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHS NEFDSDVDVGDLQMVKFIWYNNVINPTLPRVGASKIIVETNVGKQFNFCS PETVREEVLLTLTPC
    • Molecular weight
      77 kDa including tags
    • Amino acids
      1 to 465

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114950 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • lipase, pancreatic
    • LIPP_HUMAN
    • Pancreatic lipase
    • Pancreatic triacylglycerol lipase
    • PL
    • PNLIP
    • PNLIPD
    • PTL
    • Triacylglycerol acylhydrolase
    see all
  • Sequence similarities
    Belongs to the AB hydrolase superfamily. Lipase family.
    Contains 1 PLAT domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human Pancreatic Lipase protein images

  • 12.5% SDS-PAGE showing ab114950 at approximately 77.22kDa.
    Stained with Coomassie Blue.

References for Recombinant Human Pancreatic Lipase protein (ab114950)

ab114950 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114950.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up