Recombinant Human Pancreatic Lipase Related Protein 2 (ab114928)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP54317
    • SpeciesHuman
    • SequenceMLPPWTLGLLLLATVRGKEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPE DIDTRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKA EDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNIRVVGAETAFL IQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPC FQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGG KEMPGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFL GYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGE SGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDA SHTCAIDVDFNVGKIQKVKFLWNKRGINLSEPKLGASQITVQSGEDGTEY NFCSSDTVEENVLQSLYPC
    • Molecular weight78 kDa including tags
    • Amino acids1 to 469

Specifications

Our Abpromise guarantee covers the use of ab114928 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt. EC=3.1.1.3.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC 3.1.1.3
    • Galactolipase
    • LIPR2_HUMAN
    • Pancreatic lipase-related protein 2
    • PL-RP2
    • PLRP2
    • Pnliprp2
    • Secretory glycoprotein GP 3
    see all
  • FunctionLipase with broad substrate specificity. Can hydrolyze both phospholipids and galactolipids. Acts preferentially on monoglycerides, phospholipids and galactolipids. Contributes to milk fat hydrolysis.
  • Tissue specificityPancreas.
  • Sequence similaritiesBelongs to the AB hydrolase superfamily. Lipase family.
    Contains 1 PLAT domain.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human Pancreatic Lipase Related Protein 2 images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab114928.

References for Recombinant Human Pancreatic Lipase Related Protein 2 (ab114928)

ab114928 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114928.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"