Recombinant Human Pancreatic Lipase Related Protein 2 (ab114929)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      FKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVNGYIRIALYGS NENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKRGINLSEP KLG
    • Molecular weight
      37 kDa including tags
    • Amino acids
      333 to 435

Specifications

Our Abpromise guarantee covers the use of ab114929 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt. EC=3.1.1.3.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC 3.1.1.3
    • Galactolipase
    • LIPR2_HUMAN
    • Pancreatic lipase-related protein 2
    • PL-RP2
    • PLRP2
    • Pnliprp2
    • Secretory glycoprotein GP 3
    see all
  • Function
    Lipase with broad substrate specificity. Can hydrolyze both phospholipids and galactolipids. Acts preferentially on monoglycerides, phospholipids and galactolipids. Contributes to milk fat hydrolysis.
  • Tissue specificity
    Pancreas.
  • Sequence similarities
    Belongs to the AB hydrolase superfamily. Lipase family.
    Contains 1 PLAT domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human Pancreatic Lipase Related Protein 2 images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab114929.

References for Recombinant Human Pancreatic Lipase Related Protein 2 (ab114929)

ab114929 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114929.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up