Recombinant Human Pancreatic Polypeptide protein (ab114376)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP01298
    • SpeciesHuman
    • SequenceMAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYA ADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL
    • Molecular weight36 kDa including tags
    • Amino acids1 to 95

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114376 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Pancreatic polypeptide
    • Pancreatic polypeptide Y
    • Pancreatic prohormone
    • PNP
    • PP
    • PPY
    • prepro-PP (prepropancreatic polypeptide)
    see all
  • RelevancePancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions and may be important in the regulation of food intake. Plasma levels of this hormone have been shown to be reduced in conditions associated with increased food intake and elevated in anorexia nervosa. In addition, infusion of this hormone in obese rodents has shown to decrease weight gain.
  • Cellular localizationSecreted

Recombinant Human Pancreatic Polypeptide protein images

  • 12.5% SDS-PAGE with ab114376 at 36.19kDa, stained with Coomassie Blue.

References for Recombinant Human Pancreatic Polypeptide protein (ab114376)

ab114376 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114376.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"