Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKLINGKKQTFPWFGMDIGGTLVKLVYFEPKDITAEEEQEEVENLKSIRK YLTSNTAYGKTGIRDVHLELKNLTMCGRKGNLHFIRFPSCAMHRFIQMGS EKNFSSLHTTLCATGGGAFKFEEDFRMIADLQLHKLDELDCLIQGLLYVD SVGFNGKPECYYFENPTNPELCQKKPYCLDNPYPMLLVNMGSGVSILAVY SKDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALEMAAKGDSTNVDKLV KDIYGGDYERFGLQGSAVASSFGNMMSKEKRDSISKEDLARATLVTITNN IGSIARMCALNENIDRVVFVGNFLRINMVSMKLLAYAMDFWSKGQLKALF LEHEGYFGAVGALLELFKMTDDK
    • Amino acids
      1 to 373
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153362 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • coaA
    • hPanK
    • hPanK1
    • PANK
    • PANK1
    • PANK1_HUMAN
    • PANK1a
    • PANK1b
    • PanK1beta
    • Pantothenate kinase
    • Pantothenate kinase 1
    • Pantothenic acid kinase 1
    see all
  • Function
    Plays a role in the physiological regulation of the intracellular CoA concentration.
  • Tissue specificity
    Isoform 1 is expressed at high levels in brain, heart, kidney, liver, skeletal muscle and testis. Isoform 2 is detected at much lower levels in kidney, liver, brain and testis and is not detected in heart or skeletal muscle.
  • Pathway
    Cofactor biosynthesis; coenzyme A biosynthesis; CoA from (R)-pantothenate: step 1/5.
  • Sequence similarities
    Belongs to the type II pantothenate kinase family.
  • Domain
    The N-terminal extension, present in isoform 1 may be the regulatory domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab153362 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153362 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153362.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up