Recombinant Human Papillary renal cell carcinoma protein (ab159181)

Overview

  • Product name
    Recombinant Human Papillary renal cell carcinoma protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSLVAYASSDESEPDEAEPEPEEEEAVAPTSGPALGGLFASLPAPKGPAL LPPPPQMLAPAFPPPLLLPPPTGDPRLQPPPPLPFGLGGFPPPPGVSPAE AAGVGEGLGLGLPSPRGPGLNLPPPIGGAGPPLGLPKPKKRKEPVKIAAP ELHKGDSDSEEDEPTKKKTILQGSSEGTGLSALLPQPKNLTVKETNRLLL PHAFSRKPSDGSPDTKPSRLASKTKTSSLAPVVGTTTTTPSPSAIKAAAK SAALQVTKQITQEEDDSDEEVAPENFFSLPEKAEPPGVEPYPYPIPTVPE ELPPGTEPEPAFQDDAANAPLEFKMAAGSSGAPWMPKPGDDYSYNQFSTY GDANAAGAYYQDYYSGGYYPAQDPALVPTQEIAPDASFIDDEAFKRLQGK RNRGREEINFVEIKGDDQLSGAQQWMTKSLTEEKTMKSFSKKKGEQPTGQ QRRKHQITYLIHQAKERELELKNTWSENKLSRRQTQAKYGF
    • Amino acids
      1 to 491
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159181 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Papillary renal cell carcinoma (Translocation associated), isoform CRA_b
    • Papillary renal cell carcinoma translocation-associated gene protein
    • PRCC
    • PRCC_HUMAN
    • Proline rich protein PRCC
    • Proline-rich protein PRCC
    • RCCP1
    • TPRC
    see all
  • Function
    May regulate cell cycle progression through interaction with MAD2L2.
  • Tissue specificity
    Ubiquitous in fetal and adult tissues.
  • Involvement in disease
    Note=A chromosomal aberration involving PRCC is found in patients with papillary renal cell carcinoma. Translocation t(X;1)(p11.2;q21.2) with TFE3.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159181 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159181 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159181.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up