Recombinant Human PAPSS2 protein (ab160320)

Overview

  • Product name
    Recombinant Human PAPSS2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKAKKAM DFYDPARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLE
    • Amino acids
      513 to 612
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160320 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3 prime phosphoadenosine 5 prime phosphosulfate synthase 2
    • 3' phosphoadenosine 5' phosphosulfate synthase 2
    • ATP sulfurylase/adenosine 5' phosphosulfate kinase
    • ATP SULFURYLASE/ADENOSINE 5-PRIME PHOSPHOSULFATE KINASE 2
    • ATP sulfurylase/APS kinase 2
    • ATPSK2
    • Bifunctional 3' phosphoadenosine 5' phosphosulfate synthase 2
    • Bifunctional 3' phosphoadenosine 5' phosphosulfate synthethase 2
    • PAPS synthase 2
    • PAPS synthetase 2
    • PAPSS 2
    • PHOSPHOADENOSINE-PHOSPHOSULFATE SYNTHETASE 2
    • SK 2
    • SK2
    • Sulfurylase kinase 2
    see all
  • Relevance
    PAPSS2 is one of the two PAPS synthetases. Three-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS) is the sulfate donor cosubstrate for all sulfotransferase (SULT) enzymes. SULTs catalyze the sulfate conjugation of many endogenous and exogenous compounds, including drugs and other xenobiotics. In humans, PAPS is synthesized from adenosine 5-prime triphosphate (ATP) and inorganic sulfate by 2 isoforms, PAPSS1 and PAPSS2.

Images

  • ab160320 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160320 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160320.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up