Overview

  • Product name
    Recombinant Human PAQR5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLSLKLPRLFSIDQIPQVFHEQGTLFGYRHPQSSATACILSLFQMTNETL NIWTHLLPFWFFAWRFVTALYMTDIKNDSYSWPMLVYMCTSCVYPLVSSC AHTFSSMSKNARHICYFLDYGAVNLFSLGSAIAYSAYTFPDALMCTTFHD YYVALAVLNTILSTGLSCYSRFLEIQKPRLCKVIRVLAFAYPYTWDSLPI FYRLFLFPGESAQNEATSYHQKHMIMTLLASFLYSAHLPERLAPGRFDYI GHSHQLFHVCVILATHMQMEAILLDKTLRKEWLLATSKPFSFSQIAGAIL LCIIFSLSNIIYFSAALYRIPKPELHKKET
    • Amino acids
      1 to 330
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162861 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ20190
    • Membrane progestin receptor gamma
    • mPR gamma
    • MPRG
    • PAQR 5
    • Progestin and adipoQ receptor family member V
    see all
  • Relevance
    PAQR5 (Progestin and adipoQ receptor family member V) is a steroid membrane receptor which binds progesterone. It may be involved in oocyte maturation. It is an integral membrane protein and is expressed in kidney, colon, adrenal gland and lung. It belongs to the ADIPOR family.
  • Cellular localization
    Membrane; Multi-pass membrane protein.

Images

  • ab162861 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162861 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162861.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up