Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LIGKVDGTSHVTGKGVTVETVFSVDEFSASVLTGKLTTVFLPIVYTIVFV VGLPSNGMALWVFLFRTKKKHPAVIYMANLALADLLSVIWFPLKIAYHIH GNNWIYGEALCN
    • Molecular weight
      38 kDa including tags
    • Amino acids
      38 to 149

Specifications

Our Abpromise guarantee covers the use of ab152373 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Coagulation factor II receptor like 1
    • Coagulation factor II receptor-like 1
    • Coagulation factor II thrombin receptor like 1
    • F2RL1
    • G protein coupled receptor 11
    • G-protein coupled receptor 11
    • GPR11
    • PAR 2
    • PAR-2
    • PAR2_HUMAN
    • Protease activated receptor 2
    • Proteinase activated receptor 2
    • Proteinase-activated receptor 2
    • Thrombin receptor like 1
    • Thrombin receptor-like 1
    see all
  • Function
    Receptor for trypsin and trypsin-like enzymes coupled to G proteins that stimulate phosphoinositide hydrolysis. May have a role in the regulation of vascular tone.
  • Tissue specificity
    Widely expressed in tissues with especially high levels in pancreas, liver, kidney, small intestine, and colon. Moderate expression is detected in many organs, but none in brain or skeletal muscle.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Post-translational
    modifications
    A proteolytic cleavage generates a new N-terminus that functions as a tethered ligand.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152373 stained with Coomassie Blue.

References

ab152373 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152373.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up