Recombinant Human Parathyroid Hormone Receptor 1 protein (ab152639)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSG KPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEV VAVPCPDY
    • Molecular weight
      38 kDa including tags
    • Amino acids
      27 to 134

Specifications

Our Abpromise guarantee covers the use of ab152639 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC138426
    • MGC138452
    • Parathyroid hormone 1 receptor
    • Parathyroid hormone/parathyroid hormone related peptide receptor
    • Parathyroid hormone/parathyroid hormone related protein receptor
    • Parathyroid hormone/parathyroid hormone-related peptide receptor
    • PTH receptor
    • PTH/PTHr receptor
    • PTH/PTHrP receptor
    • PTH/PTHrP type I receptor
    • PTH1 receptor
    • PTH1R
    • PTH1R_HUMAN
    • PTHR
    • PTHR 1
    • PTHR1
    see all
  • Function
    Receptor for parathyroid hormone and for parathyroid hormone-related peptide. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and also a phosphatidylinositol-calcium second messenger system.
  • Tissue specificity
    Expressed in most tissues. Most abundant in kidney, bone and liver.
  • Involvement in disease
    Jansen metaphyseal chondrodysplasia
    Chondrodysplasia Blomstrand type
    Enchondromatosis multiple
    Eiken skeletal dysplasia
    Primary failure of tooth eruption
  • Sequence similarities
    Belongs to the G-protein coupled receptor 2 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152639 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152639.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up