Overview

  • Product name
    Recombinant Human PARC protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MMLLNRYSEPPGSPERAALETPIIQGQDGSPELLIRSLVGGPSAELLLDL ERVLCREGSPGGAVRPLLKRLQQETQPFLLLLRTLDAPGPNKTLLLSVLR VITRLLDF
    • Amino acids
      918 to 1025
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161538 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CUL-9
    • Cul9
    • CUL9_HUMAN
    • Cullin-9
    • DKFZp686G1042
    • DKFZp686P2024
    • H7AP1
    • KIAA0708
    • OTTHUMP00000039816
    • p53 associated parkin like cytoplasmic protein
    • p53-associated parkin-like cytoplasmic protein
    • PARC
    • parkin-like cytoplasmic p53 binding protein
    • RP3 330M21.2
    • UbcH 7 associated protein 1
    • UbcH7 associated protein 1
    • UbcH7-associated protein 1
    see all
  • Function
    Cytoplasmic anchor protein in p53-associated protein complex. Regulates the subcellular localization of p53 and subsequent function. Seems to be part of an atypical cullin-RING-based E3 ubiquitin-protein ligase complex. In vitro, complexes of CUL9/PARC with either CUL7 or TP53 contain E3 ubiquitin-protein ligase activity.
  • Tissue specificity
    Ubiquitously expressed in all tissues with highest expression in testis brain and kidney.
  • Sequence similarities
    Belongs to the cullin family.
    Contains 1 DOC domain.
    Contains 1 IBR-type zinc finger.
    Contains 2 RING-type zinc fingers.
  • Domain
    The IBR domain is required for interaction with UBCH7 and UBCH8.
  • Post-translational
    modifications
    In vitro, self-ubiquitination in the presence of E1, E2 and ubiquitin.
    Neddylated.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab161538 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161538 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161538.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up