Recombinant Human PARD3B protein (ab165136)

Overview

  • Product name
    Recombinant Human PARD3B protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SPDAFETEVAAQLAAFKPIGGEIEVTPSALKLGTPLLVRRSSDPVPGPPA DTQPSASHPGGQSLKLVVPDSTQNLEDREVLNGVQTELLTSPRTKDTLSD MTRTVEISG
    • Amino acids
      101 to 209
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165136 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ALS2CR19
    • Amyotrophic lateral sclerosis 2 (juvenile) chromosome region candidate 19
    • Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 19 protein
    • Par 3 partitioning defective 3 homolog B
    • PAR3-beta
    • PAR3-L protein
    • PAR3B
    • PAR3beta
    • PAR3L
    • PAR3L_HUMAN
    • PAR3LC
    • Pard3b
    • Partitioning defective 3 beta
    • Partitioning defective 3 homolog B
    • Partitioning defective 3-like protein
    see all
  • Function
    Putative adapter protein involved in asymmetrical cell division and cell polarization processes. May play a role in the formation of epithelial tight junctions.
  • Tissue specificity
    Highly expressed in kidney, lung and skeletal muscle. Expressed at intermediate levels in brain, heart, placenta, liver and pancreas. Isoform 1 is predominant, while isoform 2 and isoform 3 are expressed at lower levels.
  • Sequence similarities
    Belongs to the PAR3 family.
    Contains 3 PDZ (DHR) domains.
  • Domain
    The N-terminal part (1-351) part blocks the association of the tight junction marker TJP1 with the cell-cell boundary when it is overexpressed.
  • Cellular localization
    Endomembrane system. Cell junction. Cell junction > tight junction. Partially localized along the cell-cell contact region. Colocalizes with TJP1 to epithelial tight junctions.
  • Information by UniProt

Images

  • ab165136 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165136 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165136.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up