Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MNAGPGCEPCTKRPRWGAATTSPAASDARSFPSRQRRVLDPKDAHVQFRV PPSSPACVPGRAGQHRGSATSLVFKQKTITSWMDTKGIKTAESESLDSKE NNNTRIESMMSSVQKDNFYQHNVEKLENVSQLSLDKSPTEKSTQYLNQHQ TAAMCKWQNEGKHTEQLLESEPQTVTLVPEQFSNANIDRSPQNDDHSDTD SEENRDNQQFLTTVKLANAKQTTEDEQAREAKSHQKCSKSCDPGEDCASC QQDEIDVVPESPLSDVGSEDVGTGPKNDNKLTRQESCLGNSPPFEKESEP ESPMDVDNSKNSCQDSEADEETSPGFDEQEDGSSSQTANKPSRFQARDAD IEFRKRYSTKGGEVRLHFQFEGGESRTGMNDLNAKLPGNISSLNVECRNS KQHGKKDSKITDHFMRLPKAEDRRKEQWETKHQRTERKIPKYVPPHLSPD KKWLGTPIEEMRRMPRCGIRLPLLRPSANHTVTIRVDLLRAGEVPKPFPT HYKDLWDNKHVKMPCSEQNLYPVEDENGERTAGSRWELIQTALLNKFTRP QNLKDAILKYNVAYSKKWDFTALIDFWDKVLEEAEAQHLYQSILPDMVKI ALCLPNICTQPIPLLKQKMNHSITMSQEQIASLLANAFFCTFPRRNAKMK SEYSSYPDINFNRLFEGRSSRKPEKLKTLFCYFRRVTEKKPTGLVTFTRQ SLEDFPEWERCEKPLTRLHVTYEGTIEENGQGMLQVDFANRFVGGGVTSA GLVQEEIRFLINPELIISRLFTEVLDHNECLIITGTEQYSEYTGYAETYR WSRSHEDGSERDDWQRRCTEIVAIDALHFRRYLDQFVPEKMRRELNKAYC GFLRPGVSSENLSAVATGNWGCGAFGGDARLKALIQILAAAAAERDVVYF TFGDSELMRDIYSMHIFLTERKLTVGDVYKLLLRYYNEECRNCSTPGPDI KLYPFIYHAVESCAETADHSGQRTGT
    • Molecular weight
      138 kDa including tags
    • Amino acids
      1 to 976

Specifications

Our Abpromise guarantee covers the use of ab152879 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADP riboseglycohydrolase
    • Mitochondrial poly(ADP ribose) glycohydrolase
    • Parg
    • PARG_HUMAN
    • PARG99
    • Poly
    • poly (ADP ribose) glycohydrolase
    • Poly(ADP-ribose) glycohydrolase
    • poly(ADP-ribose) glycohydrolase 60 kDa isoform
    see all
  • Function
    Poly(ADP-ribose) synthesized after DNA damage is only present transiently and is rapidly degraded by poly(ADP-ribose) glycohydrolase. Poly(ADP-ribose) metabolism may be required for maintenance of the normal function of neuronal cells.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Belongs to the poly(ADP-ribose) glycohydrolase family.
  • Cellular localization
    Cytoplasm and Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152879 stained with Coomassie Blue.

References

ab152879 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152879.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up