Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO95453
    • SpeciesHuman
    • SequenceMEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTP EERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRS SPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKR SQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNL DLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERK RREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQF YCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRL KETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSF LSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHV TFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKY AESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYTLQN HYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEP LSEGRKKAKKLKRMKKELSPAGSISKNSPATLFEVPDTW
    • Molecular weight96 kDa including tags
    • Amino acids1 to 639

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114690 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DAN
    • Deadenylating nuclease
    • Deadenylation nuclease
    • PARN
    • PARN_HUMAN
    • Poly A specific ribonuclease
    • Poly(A) specific ribonuclease
    • Poly(A)-specific ribonuclease PARN
    • Polyadenylate specific ribonuclease
    • Polyadenylate-specific ribonuclease
    see all
  • Function3'-exoribonuclease that has a preference for poly(A) tails of mRNAs, thereby efficiently degrading poly(A) tails. Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs and is also used to silence certain maternal mRNAs translationally during oocyte maturation and early embryonic development. Interacts with both the 3'-end poly(A) tail and the 5'-end cap structure during degradation, the interaction with the cap structure being required for an efficient degradation of poly(A) tails. Involved in nonsense-mediated mRNA decay, a critical process of selective degradation of mRNAs that contain premature stop codons. Also involved in degradation of inherently unstable mRNAs that contain AU-rich elements (AREs) in their 3'-UTR, possibly via its interaction with KHSRP. Probably mediates the removal of poly(A) tails of AREs mRNAs, which constitutes the first step of destabilization.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the CAF1 family.
    Contains 1 R3H domain.
  • Cellular localizationNucleus. Cytoplasm. Nucleus > nucleolus. Some nuclear fraction is nucleolar.
  • Information by UniProt

Recombinant Human PARN protein images

  • ab114690 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human PARN protein (ab114690)

ab114690 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114690.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"