Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf21 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPH WYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQD GIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQ LGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLP GVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKD ELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG QLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKV KKQDRIFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGK LSRNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEEVKEAN IRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVVAPRGKSG AALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGG KVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNK LEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEE AVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGK LSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPP LLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTD IKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKP FKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKG LGKTTPDPSANISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLK YLLKLKFNFKTSLW
    • Molecular weight
      113 kDa
    • Amino acids
      1 to 1014
    • Additional sequence information
      Fused to a Myc-tag and a His-tag.

Specifications

Our Abpromise guarantee covers the use of ab157281 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Specific Activity: = 1200 U/mg protein.
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    > 98 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Preservative: 0.34% Imidazole
    Constituents: 0.2% Tergitol-NP40, 0.79% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • ADP ribosyltransferase
    • ADP ribosyltransferase (NAD+; poly (ADP ribose) polymerase)
    • ADP ribosyltransferase diphtheria toxin like 1
    • ADP ribosyltransferase NAD(+)
    • ADPRT
    • ADPRT 1
    • ADPRT1
    • ARTD1
    • msPARP
    • NAD(+) ADP ribosyltransferase 1
    • NAD(+) ADP-ribosyltransferase 1
    • pADPRT 1
    • pADPRT1
    • PARP
    • PARP 1
    • PARP-1
    • PARP1
    • PARP1_HUMAN
    • Poly (ADP ribose) polymerase 1
    • poly (ADP ribose) polymerase family, member 1
    • Poly [ADP-ribose] polymerase 1
    • Poly(ADP ribose) polymerase
    • poly(ADP ribose) synthetase
    • poly(ADP ribosyl)transferase
    • Poly[ADP ribose] synthetase 1
    • Poly[ADP-ribose] synthase 1
    • PPOL
    see all
  • Function
    Involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism. This modification follows DNA damages and appears as an obligatory step in a detection/signaling pathway leading to the reparation of DNA strand breaks. Mediates the poly(ADP-ribosyl)ation of APLF and CHFR. Positively regulates the transcription of MTUS1 and negatively regulates the transcription of MTUS2/TIP150.
  • Sequence similarities
    Contains 1 BRCT domain.
    Contains 1 PARP alpha-helical domain.
    Contains 1 PARP catalytic domain.
    Contains 2 PARP-type zinc fingers.
  • Post-translational
    modifications
    Phosphorylated by PRKDC. Phosphorylated upon DNA damage, probably by ATM or ATR.
    Poly-ADP-ribosylated by PARP2. Poly-ADP-ribosylation mediates the recruitment of CHD1L to DNA damage sites.
    S-nitrosylated, leading to inhibit transcription regulation activity.
  • Cellular localization
    Nucleus.
  • Information by UniProt

References

ab157281 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157281.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up