Recombinant Human PARP15 protein (ab165778)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLQRIGLIFLHNIVVVSNCFYFQAFLDEFTNWSRINPNKARIPMAGDTQG VVGTVSKPCFTAYEMKIGAITFQVATGDIATEQVDVIVNSTARTFNRKSG VSRAILEGAGQAVESECAVLAAQPHRDFIITPGGCLKCKIIIHVPGGKDV RKTVTSVLEECEQRKYTSVSLPAIGTGNAGKNPITVADNIIDAIVDFSSQ HSTPSLKTVKVVIFQPELLNIFYDSMKKRDLSASLNFQSTFSMTTCNLPE HWTDMNHQLFCMVQLEPGQSEYNTIKDKFTRTCSSYAIEKIERIQNAFLW QSYQVKKRQMDIKNDHKNNERLLFHGTDADSVPYVNQHGFNRSCAGKNAV SYGKGTYFAVDASYSAKDTYSKPDSNGRKHMYVVRVLTGVFTKGRAGLVT PPPKNPHNPTDLFDSVTNNTRSPKLFVVFFDNQAYPEYLITFTA
    • Amino acids
      1 to 444
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165778 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADP-ribosyltransferase diphtheria toxin-like 7
    • ARTD7
    • B aggressive lymphoma 3
    • B aggressive lymphoma protein 3
    • B-aggressive lymphoma protein 3
    • BAL3
    • FLJ40196
    • FLJ40597
    • MGC126750
    • MGC126752
    • PAR15_HUMAN
    • PARP 15
    • PARP-15
    • PARP15
    • Poly (ADP ribose) polymerase family member 15
    • Poly [ADP ribose] polymerase 15
    • Poly [ADP-ribose] polymerase 15
    see all
  • Function
    Transcriptional repressor. Has ADP-ribosyltransferase activity.
  • Sequence similarities
    Contains 2 Macro domains.
    Contains 1 PARP catalytic domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab165778 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165778 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165778.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up