Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KENGGKFSFSLNPQCTHIILDNADVLSQYQLNSIQKNHVHIANPDFIWKS IREKRLLDVKNYDPYKPLDITPPPDQKASSSEVKTEGLCPDSATEEEDTV ELTEFGMQNV
    • Amino acids
      31 to 140
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157860 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 193kDa vault protein
    • ADP ribosyltransferase (NAD+ poly (ADP ribose) polymerase) like 1
    • ADP ribosyltransferase like 1
    • ADP-ribosyltransferase diphtheria toxin-like 4
    • ADPRT L1
    • ADPRTL 1
    • ADPRTL1
    • ARTD4
    • H5 proline rich
    • I alpha I related
    • KIAA0177
    • Minor vault p193 protein
    • OTTHUMP00000042288
    • p193
    • PARP 4
    • PARP related
    • PARP related / IalphaI related H5 / proline rich
    • PARPL
    • PH 5P
    • PH5P
    • Poly (ADP ribose) polymerase 4
    • Poly (ADP ribose) polymerase family member 4
    • Poly (ADP ribose) synthetase
    • Poly (ADP ribosyl) transferase like 1
    • Poly ADP ribose polymerase 4
    • Poly ADP ribose polymerase family member 4
    • Vault
    • Vault 3
    • Vault poly (ADP ribose) polymerase
    • Vault poly ADP ribose polymerase
    • Vault protein 193 kDa
    • Vault3
    • von Willebrand factor A domain containing 5C
    • VPARP
    • VWA5C
    see all
  • Relevance
    Component of the vault ribonucleoprotein particle which is at least composed of MVP, PARP4 and one or more vault RNAs (vRNAs). Binds to MVP. Associates with TEP1. Widely expressed; the highest levels are in the kidney; also detected in heart, placenta, lung, liver, skeletal muscle, spleen, leukocytes and pancreas.
  • Cellular localization
    Cytoplasmic, but is also found in the nucleus, associated with mitotic spindles.

Images

  • ab157860 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157860 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157860.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up