Recombinant Human Parvalbumin protein (ab101107)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP20472
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMSMTDLLNAEDIKKAVGAFSATDSFD HKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDAR DLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
    • Molecular weight15 kDa including tags
    • Amino acids1 to 110
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101107 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab101107 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • D22S749
    • MGC116759
    • Parvalbumin alpha
    • PRVA_HUMAN
    • PVALB
    see all
  • FunctionIn muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions.
  • Sequence similaritiesBelongs to the parvalbumin family.
    Contains 2 EF-hand domains.
  • Information by UniProt

Recombinant Human Parvalbumin protein images

  • 15% SDS-PAGE analysis of 3µg ab101107.

References for Recombinant Human Parvalbumin protein (ab101107)

ab101107 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101107.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"