Overview

  • Product name
    Recombinant Human PASK protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEDGGLTAFEEDQRCLSQSLPLPVSAEGPAAQTTAEPSRSFSSAHRHLSR RNGLSRLCQSRTALSEDRWSSYCLSSLAAQNICTSKLHCPAAPEHTDPSE
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161560 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZP434O051
    • DKFZp686P2031
    • hPASK
    • KIAA0135
    • MGC93882
    • mKIAA0135
    • PAS domain containing serine/threonine kinase
    • PAS domain containing serine/threonine protein kinase
    • PAS domain-containing serine/threonine-protein kinase
    • PAS kinase
    • PAS serine/threonine kinase
    • PAS-kinase
    • Pask
    • PASK_HUMAN
    • PASKIN
    • STK 37
    • STK37
    see all
  • Tissue specificity
    Ubiquitously expressed, with slightly higher expression in brain, prostate and testis. Reduced expression was found in placenta.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
    Contains 2 PAS (PER-ARNT-SIM) domains.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated on Thr-1161 and Thr-1165.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab161560 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161560 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161560.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up