Overview

  • Product name
    Recombinant Human PATJ protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSIVSGGPVDT LGLLQPEDELLEVNGMQLYGKSRREAVSFLKEVPPPFTLVCCRRLFDDEA SVDEPRR
    • Amino acids
      545 to 651
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153057 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Channel interacting PDZ domain protein
    • Cipp
    • FLJ26982
    • hINADL
    • Inactivation no after potential D like protein
    • INAD like
    • InaD like Drosophila
    • INAD like protein
    • INADL
    • INADL protein
    • PALS 1 associated tight junction protein
    • PALS1 associated tight junction protein
    • PATJ
    • PDZ domain protein
    • PDZ domain protein Drosophila inaD like
    • Post synaptic density 95 / discs large / zonula occludens 1 domain protein
    • Protein associated to tight junctions
    see all
  • Relevance
    PATJ contains multiple PDZ domains. PDZ domains mediate protein-protein interactions, and proteins with multiple PDZ domains often organize multimeric complexes at the plasma membrane. PATJ localizes to tight junctions and to the apical membrane of epithelial cells. A similar protein in Drosophila is a scaffolding protein which tethers several members of a multimeric signaling complex in photoreceptors.
  • Cellular localization
    Membrane. Cell junction; tight junction. Apical cell membrane. Note: Localized in the paranodal region of myelinating Schwann cells. Membrane-associated. Localizes to tight junctions in epithelial cells. Also found at the apical plasma membrane.

Images

  • ab153057 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153057 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153057.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up