Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MERVNDASCGPSGCYTYQVSRHSTEMLHNLNQQRKNGGRFCDVLLRVGDE SFPAHRAVLAACSEYFESVFSAQLGDGGAADGGPADVGGATAAPGGGAGG SRELEMHTISSKVFGDILDFAYTSRIVVRLESFPELMTAAKFLLMRSVIE ICQEVIKQSNVQILVPPARADIMLFRPPGTSDLGFPLDMTNGAALAANSN GIAGSMQPEEEAARAAGAAIAGQASLPVLPGVDRLPMVAGPLSPQLLTSP FPSVASSAPPLTGKRGRGRPRKANLLDSMFGSPGGLREAGILPCGLCGKV FTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSR TRKQVACEICGKIFRDVYHLNRHKLSHSGEKPYSCPVCGLRFKRKDRMSY HVRSHDGSVGKPYICQSCGKGFSRPDHLNGHIKQVHTSERPHKCQVWVGS SSGLPPLEPLPSDLPSWDFAQPALWRSSHSVPDTAFSLSLKKSFPALENL GPAHSSNTLFCPAPPGYLRQGWTTPEGSRAFTQWPVG
    • Amino acids
      1 to 537
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161706 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 8430401L15Rik
    • AI447519
    • and zinc finger-containing protein 1
    • AT hook-
    • BTB POZ domain zinc finger transcription factor
    • BTB/POZ domain zinc finger transcription factor
    • dJ400N23
    • Mazr
    • PATZ
    • PATZ1
    • PATZ1_HUMAN
    • POZ (BTB) and AT hook containing zinc finger 1
    • POZ , AT hook, and zinc finger containing protein 1
    • POZ-
    • Protein kinase A RI subunit alpha associated protein
    • Protein kinase A RI subunit alpha-associated protein
    • RIAZ
    • Transcription factor MAZR
    • ZBTB19
    • Zfp278
    • Zinc finger and BTB domain containing protein 19
    • Zinc finger and BTB domain-containing protein 19
    • Zinc finger protein 278
    • Zinc finger protein 278, isoform CRA_d
    • Zinc finger sarcoma gene protein
    • ZNF278
    • ZSG
    see all
  • Function
    Transcriptional repressor.
  • Tissue specificity
    Ubiquitous.
  • Involvement in disease
    A chromosomal aberration involving PATZ1 is associated with small round cell sarcoma. Translocation t(1;22)(p36.1;q12) with EWSR1.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 1 A.T hook DNA-binding domain.
    Contains 1 BTB (POZ) domain.
    Contains 7 C2H2-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab161706 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161706 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161706.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up