Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP23759
    • SpeciesHuman
    • SequenceGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGY QYGQYGQSECLVPWASPVPIPSPTPRASCLFMESYKVVSGWGMSISQMEK LKSSQMEQFT
    • Molecular weight38 kDa including tags
    • Amino acids411 to 521

Specifications

Our Abpromise guarantee covers the use of ab114237 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ37460
    • HUP1
    • OTTHUMP00000002534
    • Paired box 7
    • Paired box gene 7
    • Paired box homeotic gene 7
    • Paired box protein Pax-7
    • Paired domain gene 7
    • Paired domain gene HuP1
    • Pax7
    • PAX7 transcriptional factor
    • PAX7/FKHR fusion gene, included
    • PAX7_HUMAN
    • PAX7B
    • RGD1564360
    • RMS2
    see all
  • FunctionProbable transcription factor. May have a role in myogenesis.
  • Involvement in diseaseDefects in PAX7 are a cause of rhabdomyosarcoma type 2 (RMS2) [MIM:268220]. It is a form of rhabdomyosarcoma, a highly malignant tumor of striated muscle derived from primitive mesenchimal cells and exhibiting differentiation along rhabdomyoblastic lines. Rhabdomyosarcoma is one of the most frequently occurring soft tissue sarcomas and the most common in children. It occurs in four forms: alveolar, pleomorphic, embryonal and botryoidal rhabdomyosarcomas. Note=A chromosomal aberration involving PAX7 is found in rhabdomyosarcoma. Translocation t(1;13)(p36;q14) with FOXO1. The resulting protein is a transcriptional activator.
  • Sequence similaritiesBelongs to the paired homeobox family.
    Contains 1 homeobox DNA-binding domain.
    Contains 1 paired domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human PAX7 protein images

  • 12.5% SDS-PAGE showing ab114237 at approximately 38.21kDa stained with Coomassie Blue.

References for Recombinant Human PAX7 protein (ab114237)

ab114237 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114237.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"