Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQ LRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQ N PTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDS CVA TKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSD KRKMD DSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFER QHYPEAY ASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLS THQTYPVVA DPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSG VPPFNAFPHAA SVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSY ASSAIAGMVAGSE YSGNAYGHTPYSSYSEAWRFPNSSLLSSPYYYSST SRPSAPPTTATAFDH L
    • Molecular weight
      75 kDa including tags
    • Amino acids
      1 to 451

Specifications

Our Abpromise guarantee covers the use of ab112376 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    useful for Antibody Production and Protein Array
  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    ab112376 is best used within three months from the date of receipt.useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • OTTHUMP00000158659
    • OTTHUMP00000158660
    • OTTHUMP00000203723
    • OTTHUMP00000203724
    • Paired box 8
    • Paired box gene 8
    • paired box homeotic gene 8
    • Paired box protein Pax 8
    • Paired box protein Pax-8
    • Paired domain gene 8
    • PAX 8
    • PAX8
    • PAX8_HUMAN
    see all
  • Function
    Transcription factor for the thyroid-specific expression of the genes exclusively expressed in the thyroid cell type, maintaining the functional differentiation of such cells.
  • Tissue specificity
    Expressed in the excretory system, thyroid gland and Wilms tumors.
  • Involvement in disease
    Defects in PAX8 are the cause of congenital hypothyroidism non-goitrous type 2 (CHNG2) [MIM:218700]. CHNG2 is a disease characterized by thyroid dysgenesis, the most frequent cause of congenital hypothyroidism, accounting for 85% of case. The thyroid gland can be completely absent (athyreosis), ectopically located and/or severely hypoplastic. Ectopic thyroid gland is the most frequent malformation, with thyroid tissue being found most often at the base of the tongue.
  • Sequence similarities
    Contains 1 paired domain.
  • Developmental stage
    In developing excretory system, during thyroid differentiation and in adult thyroid.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human PAX8 protein images

  • ab112376 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human PAX8 protein (ab112376)

ab112376 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112376.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up