Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQ LRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQ N PTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDS CVA TKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSD KRKMD DSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFER QHYPEAY ASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLS THQTYPVVA DPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSG VPPFNAFPHAA SVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSY ASSAIAGMVAGSE YSGNAYGHTPYSSYSEAWRFPNSSLLSSPYYYSST SRPSAPPTTATAFDH L
    • Molecular weight
      75 kDa including tags
    • Amino acids
      1 to 451

Specifications

Our Abpromise guarantee covers the use of ab112376 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    useful for Antibody Production and Protein Array
  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    ab112376 is best used within three months from the date of receipt.useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • OTTHUMP00000158659
    • OTTHUMP00000158660
    • OTTHUMP00000203723
    • OTTHUMP00000203724
    • Paired box 8
    • Paired box gene 8
    • paired box homeotic gene 8
    • Paired box protein Pax 8
    • Paired box protein Pax-8
    • Paired domain gene 8
    • PAX 8
    • PAX8
    • PAX8_HUMAN
    see all
  • Function
    Transcription factor for the thyroid-specific expression of the genes exclusively expressed in the thyroid cell type, maintaining the functional differentiation of such cells.
  • Tissue specificity
    Expressed in the excretory system, thyroid gland and Wilms tumors.
  • Involvement in disease
    Defects in PAX8 are the cause of congenital hypothyroidism non-goitrous type 2 (CHNG2) [MIM:218700]. CHNG2 is a disease characterized by thyroid dysgenesis, the most frequent cause of congenital hypothyroidism, accounting for 85% of case. The thyroid gland can be completely absent (athyreosis), ectopically located and/or severely hypoplastic. Ectopic thyroid gland is the most frequent malformation, with thyroid tissue being found most often at the base of the tongue.
  • Sequence similarities
    Contains 1 paired domain.
  • Developmental stage
    In developing excretory system, during thyroid differentiation and in adult thyroid.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab112376 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References

ab112376 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112376.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up