Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHENLYFQGGEFEGISNFKTPSKLSEKKKSVLC STPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICND HYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKS LNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSN VVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENG VITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYY AALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV
    • Molecular weight
      39 kDa including tags
    • Amino acids
      2 to 322
    • Additional sequence information
      Expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal.

Specifications

Our Abpromise guarantee covers the use of ab190388 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab190388 was refolded using temperature shift inclusion body refolding technology and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • Cancer/testis antigen 84
    • CT84
    • Epididymis luminal protein 164
    • FLJ14385
    • HEL164
    • Lymphokine activated killer T cell originated protein kinase
    • Lymphokine-activated killer T-cell-originated protein kinase
    • MAPKK like protein kinase
    • MAPKK-like protein kinase
    • Nori 3
    • Nori-3
    • Nori3
    • PBK
    • PDZ binding kinase
    • PDZ-binding kinase
    • Serine/threonine protein kinase
    • Spermatogenesis related protein kinase
    • Spermatogenesis-related protein kinase
    • SPK
    • T LAK cell originated protein kinase
    • T-LAK cell-originated protein kinase
    • TOPK
    • TOPK_HUMAN
    see all
  • Function
    Phosphorylates MAP kinase p38. Seems to be active only in mitosis. May also play a role in the activation of lymphoid cells. When phosphorylated, forms a complex with TP53, leading to TP53 destabilization and attenuation of G2/M checkpoint during doxorubicin-induced DNA damage.
  • Tissue specificity
    Expressed in the testis and placenta. In the testis, restrictedly expressed in outer cell layer of seminiferous tubules.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase kinase subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Phosphorylated; in a cell-cycle dependent manner at mitosis.
  • Information by UniProt

References

ab190388 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190388.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up