Overview

  • Product name
    Recombinant Human PBLD protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMKLPIFIADAFTARAFRGNPAAVCLLENEL DEDMHQKIAREMNLSETAFIRKLHPTDNFAQSSCFGLRWFTPASEVPLCG HATLASAAVLFHKIKNMNSTLTFVTLSGELRARRAEDGIVLDLPLYPAHP QDFHEVEDLIKTAIGNTLVQDICYSPDTQKLLVRLSDVYNRSFLENLKVN TENLLQVENTGKVKGLILTLKGEPGGQTQAFDFYSRYFAPWVGVAEDPVT GSAHAVLSSYWSQHLGKKEMHAFQCSHRGGELGISLRPDGRVDIRGGAAV VLEGTLTA
    • Molecular weight
      34 kDa
    • Amino acids
      1 to 288
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101217 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab101217 was purified using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: 0% None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • FLJ14767
    • FLJ35507
    • MAWBP
    • MAWD binding protein
    • MAWD-binding protein
    • MAWDBP
    • OTTHUMP00000019698
    • OTTHUMP00000082489
    • PBLD
    • PBLD_HUMAN
    • Phenazine biosynthesis like domain containing protein
    • Phenazine biosynthesis like protein domain containing
    • Phenazine biosynthesis-like domain-containing protein
    • Unknown protein 32 from 2D page of liver tissue
    • Unknown protein 32 from 2D-page of liver tissue
    see all
  • Sequence similarities
    Belongs to the phzF family.
  • Information by UniProt

Recombinant Human PBLD protein images

  • ab101217 at 3 µg analysed by 15% SDS PAGE.

References for Recombinant Human PBLD protein (ab101217)

ab101217 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101217.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up