Overview

  • Product name
    Recombinant Human PBLD protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMKLPIFIADAFTARAFRGNPAAVCLLENEL DEDMHQKIAREMNLSETAFIRKLHPTDNFAQSSCFGLRWFTPASEVPLCG HATLASAAVLFHKIKNMNSTLTFVTLSGELRARRAEDGIVLDLPLYPAHP QDFHEVEDLIKTAIGNTLVQDICYSPDTQKLLVRLSDVYNRSFLENLKVN TENLLQVENTGKVKGLILTLKGEPGGQTQAFDFYSRYFAPWVGVAEDPVT GSAHAVLSSYWSQHLGKKEMHAFQCSHRGGELGISLRPDGRVDIRGGAAV VLEGTLTA
    • Molecular weight
      34 kDa
    • Amino acids
      1 to 288
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101217 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab101217 was purified using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: 0% None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • FLJ14767
    • FLJ35507
    • MAWBP
    • MAWD binding protein
    • MAWD-binding protein
    • MAWDBP
    • OTTHUMP00000019698
    • OTTHUMP00000082489
    • PBLD
    • PBLD_HUMAN
    • Phenazine biosynthesis like domain containing protein
    • Phenazine biosynthesis like protein domain containing
    • Phenazine biosynthesis-like domain-containing protein
    • Unknown protein 32 from 2D page of liver tissue
    • Unknown protein 32 from 2D-page of liver tissue
    see all
  • Sequence similarities
    Belongs to the phzF family.
  • Information by UniProt

Images

  • ab101217 at 3 µg analysed by 15% SDS PAGE.

References

ab101217 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101217.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up