Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRP TSISWDG LDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDIS SGTVLSDYVGSGPPKG TGLHRYVWLVYEQDRPLKCDEPILSNRSGDHR GKFKVASFRKKYELRAPVAGTCYQA EWDDYVPKLYEQLSGK

Specifications

Our Abpromise guarantee covers the use of ab88461 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab88461 was purified using affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • Epididymis luminal protein 210
    • Epididymis secretory protein Li 34
    • Epididymis secretory protein Li 96
    • HCNP
    • HCNPpp
    • HEL 210
    • HEL S 34
    • HEL S 96
    • Hippocampal cholinergic neurostimulating peptide
    • Neuropolypeptide h3
    • PBP
    • PEBP
    • PEBP 1
    • PEBP-1
    • Pebp1
    • PEBP1_HUMAN
    • Phosphatidylethanolamine binding protein
    • Phosphatidylethanolamine binding protein 1
    • Prostatic binding protein
    • Prostatic-binding protein
    • R kip
    • Raf kinase inhibitor protein
    • Raf kinase inhibitory protein
    • RKIP
    see all
  • FunctionBinds ATP, opioids and phosphatidylethanolamine. Has lower affinity for phosphatidylinositol and phosphatidylcholine. Serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase.
    HCNP may be involved in the function of the presynaptic cholinergic neurons of the central nervous system. HCNP increases the production of choline acetyltransferase but not acetylcholinesterase. Seems to be mediated by a specific receptor.
  • Sequence similaritiesBelongs to the phosphatidylethanolamine-binding protein family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

References for Recombinant Human PBP protein (ab88461)

ab88461 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88461.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"