Recombinant Human PBXIP1 protein (ab163534)

Overview

  • Product name
    Recombinant Human PBXIP1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DGQRDRKAEHWKHKKEESGRERKKNWGGQEDREPAGRWKEGRPRVEESGS KKEGKRQGPKEPPRKSGSFHSSGEKQKQPRWREGTKDSHDPLPSWAELL
    • Amino acids
      480 to 578
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163534 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4732463H20Rik
    • Hematopoietic PBX interacting protein
    • HPIP
    • MGC38361
    • Pre B cell leukemia homeobox interacting protein 1
    • RP11-307C12.2
    see all
  • Relevance
    PBXIP1 is a regulator of pre-B-cell leukemia transcription factors (BPXs) function. It inhibits the binding of PBX1-HOX complex to DNA and blocks the transcriptional activity of E2A-PBX1. PBXIP1 also tethers estrogen receptor-alpha (ESR1) to microtubules and allows them to influence estrogen receptors-alpha signaling.
  • Cellular localization
    Cytoplasm, cytoskeleton. Nucleus. Note=Shuttles between the nucleus and the cytosol. Mainly localized in the cytoplasm, associated with microtubules. Detected in small amounts in the nucleus.

Images

  • ab163534 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163534 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163534.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up