Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDISCLTCNGPGFKNC TSCPSGYLLDLGMCQMGAICKDATEESWAEGGFCMLVKKNNLCQRKVLQQ LCCKTCTFQG
    • Molecular weight
      38 kDa including tags
    • Amino acids
      804 to 913

Specifications

Our Abpromise guarantee covers the use of ab114944 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ11149
    • FLJ16215
    • hPC6
    • PC5
    • PC6
    • PC6A
    • Pcsk5
    • PCSK5_HUMAN
    • Prohormone convertase 5
    • Proprotein convertase 5
    • Proprotein convertase 6
    • Proprotein convertase PC5
    • Proprotein convertase subtilisin/kexin type 5
    • Protease PC6
    • SPC6
    • Subtilisin/kexin-like protease PC5
    see all
  • Function
    Likely to represent a widespread endoprotease activity within the constitutive and regulated secretory pathway. Capable of cleavage at the RX(K/R)R consensus motif.
  • Tissue specificity
    Expressed in T-lymphocytes.
  • Sequence similarities
    Belongs to the peptidase S8 family.
    Contains 1 homo B/P domain.
    Contains 1 PLAC domain.
  • Domain
    The propeptide domain acts as an intramolecular chaperone assisting the folding of the zymogen within the endoplasmic reticulum.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human PC6 protein images

  • ab114944 analyzed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human PC6 protein (ab114944)

ab114944 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114944.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up