Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDISCLTCNGPGFKNC TSCPSGYLLDLGMCQMGAICKDATEESWAEGGFCMLVKKNNLCQRKVLQQ LCCKTCTFQG
    • Molecular weight
      38 kDa including tags
    • Amino acids
      804 to 913

Specifications

Our Abpromise guarantee covers the use of ab114944 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ11149
    • FLJ16215
    • hPC6
    • PC5
    • PC6
    • PC6A
    • Pcsk5
    • PCSK5_HUMAN
    • Prohormone convertase 5
    • Proprotein convertase 5
    • Proprotein convertase 6
    • Proprotein convertase PC5
    • Proprotein convertase subtilisin/kexin type 5
    • Protease PC6
    • SPC6
    • Subtilisin/kexin-like protease PC5
    see all
  • Function
    Likely to represent a widespread endoprotease activity within the constitutive and regulated secretory pathway. Capable of cleavage at the RX(K/R)R consensus motif.
  • Tissue specificity
    Expressed in T-lymphocytes.
  • Sequence similarities
    Belongs to the peptidase S8 family.
    Contains 1 homo B/P domain.
    Contains 1 PLAC domain.
  • Domain
    The propeptide domain acts as an intramolecular chaperone assisting the folding of the zymogen within the endoplasmic reticulum.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab114944 analyzed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114944 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114944.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up