Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINIS EGNCPERIITLTGPTNAIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTL RLVVPATQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAG VPQSVTECVKQICLVMLETLSQSPQGRVMTIPYQPMPASSPVICAGGQDR CSDAVGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAM MHGGTGFAGIDSSSPEVKGYWASLDASTQTTHELTIPNNLIGCIIGRQGA NINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLAQYLINARLSSE KGMGCS
    • Molecular weight
      65 kDa including tags
    • Amino acids
      1 to 356

Specifications

Our Abpromise guarantee covers the use of ab114889 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Alpha-CP1
    • Heterogeneous nuclear ribonucleoprotein E1
    • heterogenous nuclear ribonucleoprotein E1
    • heterogenous nuclear ribonucleoprotein X
    • hnRNP E1
    • hnRNP-E1
    • hnRNP-X
    • HNRPE1
    • HNRPX
    • nucleic acid binding protein sub 2.3
    • Nucleic acid- binding protein SUB2.3
    • Nucleic acid-binding protein SUB2.3
    • PCBP1
    • PCBP1_HUMAN
    • poly(rC) binding protein 1
    • Poly(rC)-binding protein 1
    • rCbinding protein 1
    see all
  • Function
    Single-stranded nucleic acid binding protein that binds preferentially to oligo dC.
  • Tissue specificity
    Abundantly expressed in skeletal muscle, thymus and peripheral blood leukocytes while a lower expression is observed in prostate, spleen, testis, ovary, small intestine, heart, liver, adrenal and thyroid glands.
  • Sequence similarities
    Contains 3 KH domains.
  • Post-translational
    modifications
    Phosphorylated; lowers poly(rC)-binding activity.
  • Cellular localization
    Nucleus. Cytoplasm. Loosely bound in the nucleus. May shuttle between the nucleus and the cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114889 at approximately 65.23kDa.
    Stained with Coomassie Blue.

References

ab114889 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114889.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up